PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn135381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 324aa    MW: 36138.6 Da    PI: 7.7494
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn135381genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.53.4e-33112167359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  +++YkeClkNhAa++Ggh+vDGCgEfmp  ge+gt++al+CaAC+CHRnFHRreve 
   Achn135381 112 TITYKECLKNHAANMGGHVVDGCGEFMPG-GEDGTPEALRCAACDCHRNFHRREVEG 167
                  789*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-21111168IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-30113165IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.2E-31114165IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.26115164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.0E-29254321IPR009057Homeodomain-like
SuperFamilySSF466891.55E-19254320IPR009057Homeodomain-like
PROSITE profilePS500718.697257321IPR001356Homeobox domain
TIGRFAMsTIGR015651.6E-26259316IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEIRGQEKDM GMPMGYSTTN LSQPHQDSSS KMFAASMATD RRRNDTLDHH YPNQQIDLKQ  60
LQQQQNTPME AINQSQDLDP DPAAIASVTI GTTSNSKTPT PPPPEPTTLA ATITYKECLK  120
NHAANMGGHV VDGCGEFMPG GEDGTPEALR CAACDCHRNF HRREVEGEPH PVTNSHYHYN  180
HSRNNIHRAT TQLVPPLLPP PPPPHHHHRY SSHGPIPPVM MAFGGASGAP AESSSEDLSM  240
FHANIGAQAM GQPPFSPSKK RFRTKFTQGQ KDKMQEFAER LEWKMQKHDE QQVEQFCAEV  300
GVKRQVFKVW MHNNKQAMKK KQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-232603171875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804697.11e-108PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A068U3223e-99A0A068U322_COFCA; Uncharacterized protein
STRINGPOPTR_0005s12420.14e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.18e-56homeobox protein 24